PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003816G0150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 571aa    MW: 60739.1 Da    PI: 7.0861
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003816G0150genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.2e-093353721954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  PH01003816G0150 335 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 372
                      554459******************************88 PP

2BELL98.17.2e-32198268272
             BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +elq+ kakL ++leeVd+rY++y+eq+++v++sFeavag  s+++Yt+lA+++iSrhFr+L+d ++ qi
  PH01003816G0150 198 AAELQRLKAKLYTMLEEVDRRYRRYCEQMRAVAGSFEAVAGERSSAVYTKLASRTISRHFRSLRDGVVAQI 268
                      5799*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.6E-42133266IPR006563POX domain
PfamPF075262.5E-41141264IPR006563POX domain
PROSITE profilePS5007112.115313376IPR001356Homeobox domain
CDDcd000861.77E-12316377No hitNo description
SMARTSM003892.5E-9316380IPR001356Homeobox domain
SuperFamilySSF466892.52E-17317384IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-28319382IPR009057Homeodomain-like
PfamPF059207.4E-18333372IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MAHDPSLGYA DYLAAGAGGG GASTLVPEVD AGNPELYGLH QPGGVEMFGV RGLVPAAMTA  60
APAQSKAALV DVDGSSTIQF VLGEQLQHRQ MSQAPLSLSL HRPAEAASSL MLHHQLRSGA  120
LRQHQQPTPA AWMQGAWHPR CSRFLLPTQQ LLHEFCSLPV ESTNSPAKPP KPAAQEDGGG  180
SSSSASWTPS AQIQTMDAAE LQRLKAKLYT MLEEVDRRYR RYCEQMRAVA GSFEAVAGER  240
SSAVYTKLAS RTISRHFRSL RDGVVAQIQA VGKALGEKDT AVPGMTKGET PRLRVLDQCL  300
RQHKAYQAGM LESHPWRPQR GLPERAVSVL RAWLFEHFLH PYPSDVDKHI LARQTGLSRS  360
QVSNWFINAR VRLWKPMVEE MYSEEMKDQE GSGQSQVSNL QNPNPSSYTS EGRGGEGGGE  420
KKPTRAQLLH DAGSLASVVS IGSGAGRMDH QSINFGMMDP LDFGAYEAAG GQGFGGGIAG  480
GVSLTLGLQQ HADSHGGVNV AFAAPSSAVQ GGATEFLFMD GEQQMGGAGG GVHSAHGHHS  540
QFGASMDGDA ASHYRGLSAT GFQLLHDLAG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17322379158Homeobox protein Meis1
4xrs_B5e-17322379158Homeobox protein Meis1
5bng_A6e-17322380159Homeobox protein Meis2
5bng_B6e-17322380159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0680290.0AK068029.1 Oryza sativa Japonica Group cDNA clone:J013134A07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614125.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLA0A0E0R1T50.0A0A0E0R1T5_ORYRU; Uncharacterized protein
STRINGLOC_Os10g39030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.18e-92TALE family protein